If you have been reading about Selank and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-01-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Selank is a synthetic heptapeptide developed in Russia during the 1990s. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences designed it as a stabilized analog of tuftsin, a naturally occurring immunomodulatory tetrapeptide. The compound has been studied primarily for its reported anxiolytic and nootropic effects. It remains largely unknown in Western pharmacology and is not approved as a medicine by major regulators such as the FDA or the EMA.
The primary structure of Selank is Thr-Lys-Pro-Arg-Pro-Gly-Pro, corresponding to the molecular formula C33H57N11O9 and a monoisotopic mass of roughly 751.9 daltons. The N-terminal threonine and the arginine residue in the fourth position are shared with tuftsin, which carries the sequence Thr-Lys-Pro-Arg. The three additional residues at the C-terminus, Pro-Gly-Pro, extend the chain and are associated with greater resistance to enzymatic degradation. This extension also separates Selank from the shorter parent peptide.
Dry powder is normally held at -20 degrees Celsius or lower, in a sealed container with desiccant and protection from light. Reconstituted solutions are usually kept at 2 to 8 degrees Celsius for short periods and frozen for longer ones. Proline residues at several positions are generally associated with some resistance to peptidase attack, but chemical stability still declines at neutral to alkaline pH and at elevated temperature. Exact shelf-life figures are product-specific and are not standardised across suppliers.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, with mass spectrometry used to confirm molecular mass and sequence information. Amino acid analysis and peptide mapping may supplement these methods. Certified reference standards are scarce, and many commercial lots are sold as research chemicals without a pharmacopoeial monograph. Regulatory treatment differs by country: Selank is a registered prescription medicine in Russia, while in the European Union and the United States it is not an approved drug and may fall under research-chemical or unapproved-product frameworks.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic heptapeptide | Stabilized analog of tuftsin |
| Sequence | Thr-Lys-Pro-Arg-Pro-Gly-Pro | Single-letter form: TKPRPGP |
| Molecular formula | C33H57N11O9 | Monoisotopic mass about 751.9 Da |
| Appearance | White to off-white powder | Typically supplied as lyophilized solid |
| Solubility | Freely soluble in water | Also soluble in common polar solvents |
Published work on this peptide almost always uses intranasal delivery, with drops or a spray applied to the nasal mucosa. Some animal experiments have used subcutaneous or intraperitoneal injection, and a smaller number have compared routes directly. Oral administration is not a focus of the literature, because short peptides of this size are broken down by digestive enzymes and cross intestinal barriers poorly. How much of an intranasal dose reaches the bloodstream intact in humans remains an open question.
Animal studies have examined behaviour in tests of anxiety, memory retention and stress response, and several report changes in neurotrophic or neurotransmitter-related markers. The human evidence base is much smaller, consisting mainly of short trials conducted in Russia with limited reporting in English-language journals. Sample sizes are modest and outcome measures vary between studies, so the findings are best described as preliminary. Independent replication under modern trial standards has not been widely reported.
Outside its country of origin the compound is generally handled as a research chemical rather than an approved medicine. No regulatory approval from the United States Food and Drug Administration or the European Medicines Agency has been granted for human use. Identity and purity are normally checked by reverse-phase high-performance liquid chromatography, with mass spectrometry used to confirm the molecular mass. Lyophilised material is stored cold and desiccated, and repeated freeze-thaw cycles are avoided.
Lyophilized material is generally stable for extended periods when kept dry at or below minus twenty degrees Celsius. Working solutions are less stable, and common practice is to aliquot and freeze them so that repeated freeze-thaw cycles are avoided. Aqueous solutions are sensitive to pH extremes and to microbial growth, so short-term storage at refrigerator temperature is typical. Oxidation and hydrolysis are the principal degradation routes. Reconstitution with sterile water or a mild buffer is standard, and solutions should be protected from light.
Regulatory treatment varies by jurisdiction. In Russia the compound is a registered prescription product, while in the European Union and the United States it is generally handled as a research chemical without a marketing authorization. Suppliers therefore operate outside pharmaceutical oversight, and buyers rely on supplier documentation for purity and identity claims. Chain of custody and third-party testing are the main verification tools. Analysts note that the absence of a pharmacopoeial monograph for research-grade material limits standardization across vendors.
Purity assessment relies mainly on reverse-phase high-performance liquid chromatography with ultraviolet detection. Because the peptide lacks a strong chromophore, detection often uses backbone absorbance near 214 nm. Identity is confirmed by mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, comparing the measured mass against the expected value. Amino acid analysis can verify composition after acid hydrolysis. Diastereomer content and residual counterions are reported less often, although both can influence biological assays.
In molecular biology, the BSD domain is an approximately 60-amino-acid-long protein domain named after the BTF2-like transcription factors, synapse-associated proteins and DOS2-like proteins in which it is found. It is also found in several hypothetical proteins. It occurs in one or two copies in a variety of species ranging from primal protozoan to human, and can be found associated with other domains such as the BTB domain or the U-box in multidomain proteins. Its function is as yet unknown. Secondary structure prediction indicates the presence of three predicted alpha helices, which probably form a three-helical bundle in small |domains. The third predicted helix contains neighbouring phenylalanine and tryptophan residues—less common amino acids that are invariant in all the BSD domains identified and that are the domain's most striking sequence features. Some proteins known to contain one or two BSD domains are:
Sensory evoked potentials (SEP) are recorded from the central nervous system following stimulation of sense organs, for example, visual evoked potentials elicited by a flashing light or changing pattern on a monitor, auditory evoked potentials by a click or tone stimulus presented through earphones), or tactile or somatosensory evoked potential (SSEP) elicited by tactile or electrical stimulation of a sensory or mixed nerve in the periphery. Sensory evoked potentials have been widely used in clinical diagnostic medicine since the 1970s, and also in intraoperative neurophysiology monitoring (IONM), also known as surgical neurophysiology. There are three kinds of evoked potentials in widespread clinical use: auditory evoked potentials, usually recorded from the scalp but originating at brainstem level; visual evoked potentials, and somatosensory evoked potentials, which are elicited by electrical stimulation of peripheral nerve. Examples of SEP usage include:
Analysis of molecular variance (AMOVA), is a statistical model for the molecular algorithm in a single species, typically biological. The name and model are inspired by ANOVA. The method was developed by Laurent Excoffier, Peter Smouse and Joseph Quattro at Rutgers University in 1992. Since developing AMOVA, Excoffier has written a program for running such analyses. This program, which runs on Windows, is called Arlequin and is freely available on Excoffier's website. There are also implementations in R language in the ade4 and the pegas packages, both available on CRAN (Comprehensive R Archive Network). Another implementation is in Info-Gen, which also runs on Windows. The student version is free and fully functional. Native language of the application is Spanish but an English version is also available. An additional free statistical package, GenAlEx, is geared toward teaching as well as research and allows for complex genetic analyses to be employed and compared within the commonly used Microsoft Excel interface. This software allows for calculation of analyses such as AMOVA, as well as comparisons with other types of closely related statistics including F-statistics and Shannon's index, and more.
The FMO method is implemented in GAMESS (US), ABINIT-MP, PAICS, and OpenFMO software packages, distributed free of charge. Fu, is a general open-source GUI that can generate input files for FMO. Another graphical user interface Facio developed by M. Suenaga has a very convenient specialised support of FMO (in addition to other features), with which an automatic fragmentation of molecular clusters, proteins, nucleotides, saccharides and any combination thereof (e.g., DNA and protein complexes in explicit solvent) can be done in a few minutes, and a manual fragmentation of solids and surfaces can be accomplished by clicking the bonds to be detached. Facio can also visualise results of FMO calculations, such as the pair interactions. (E – energy, G – gradient, H – Hessian; bold – can be used with PCM) GAMESS (US)
Sources: en.wikipedia.org
Recent advances have enabled simultaneous profiling of chromatin accessibility alongside other molecular modalities in the same cells or tissue sections. Spatial ATAC–RNA-seq and spatial CUT&Tag–RNA-seq allow co-profiling of genome-wide chromatin accessibility or histone modifications in conjunction with whole transcriptome on the same tissue section at near-single-cell resolution. ISSAAC-seq (In Situ Sequencing of chromatin Accessibility And Cellular transcriptomes) represents a multimodal update to ATAC-seq, providing a powerful method for investigating gene expression and chromatin accessibility within the same cell at high sensitivity and lower cost than commercially available kits. These multimodal approaches have led to the development of computational tools like SCRIPro, which combines transcription factor-target importance from epigenomic data with transcription factor-target expression from transcriptomic data to construct gene regulatory networks from single-cell and spatial multiomics data.
H3A (aq) + H2O (l) ⇌ H3O+ (aq) + H2A− (aq) Ka1 H2A− (aq) + H2O (l) ⇌ H3O+ (aq) + HA2− (aq) Ka2 HA2− (aq) + H2O (l) ⇌ H3O+ (aq) + A3− (aq) Ka3 An inorganic example of a triprotic acid is orthophosphoric acid (H3PO4), usually just called phosphoric acid. All three protons can be successively lost to yield H2PO−4, then HPO2−4, and finally PO3−4, the orthophosphate ion, usually just called phosphate. Even though the positions of the three protons on the original phosphoric acid molecule are equivalent, the successive Ka values differ since it is energetically less favorable to lose a proton if the conjugate base is more negatively charged. An organic example of a triprotic acid is citric acid, which can successively lose three protons to finally form the citrate ion. Although the subsequent loss of each hydrogen ion is less favorable, all of the conjugate bases are present in solution. The fractional concentration, α (alpha), for each species can be calculated. For example, a generic diprotic acid will generate 3 species in solution: H2A, HA−, and A2−. The fractional concentrations can be calculated as below when given either the pH (which can be converted to the [H+]) or the concentrations of the acid with all its conjugate bases:
Antidotes are agents that can neutralise the effects of a poison or toxin. Antidotes counteract the effects of toxins in many ways, such as by blocking the absorption of the toxin, binding and neutralising the poison, opposing the toxin's end-organ function, or blocking the toxin's conversion to more hazardous metabolites. In addition to lowering the amount of free or active poison present, antidote delivery may also lessen the toxin's effects on organs through competitive inhibition, receptor blockage, or direct antagonistic interaction. The therapeutic index or ratio (TD50/ED50), which is the ratio of the toxic dosage (TD) or fatal dose (LD) to the effective dose (ED), determines the level of safety associated with a substance.
Sources: en.wikipedia.org
44. Adv Gerontol. 2004;13:90-3. [Effect of epitalon on the immunity and hemostasis in hypophysectomized chicken and old hens]. [Article in Russian] Kuznik BI, Pateiuk AV, Khavinson VKh, Malinin VV. Neonatal hypophysectomy in chicken, as well as that in old hen has been established to entail in 1,5 months after surgery cellular and humoral immunity disturbances, pronounced hypercoagulation and fibrinolysis depression. Administration of Epitalon (Ala-Glu-Asp-Gly) to a large extent eliminates revealed shifts. This effect appeared to be stronger in neonatally hypophysectomized chicken than in old hens.
Biopolymers are natural polymers produced by the cells of living organisms. Like other polymers, biopolymers consist of monomeric units that are covalently bonded in chains to form larger molecules. There are three main classes of biopolymers, classified according to the monomers used and the structure of the biopolymer formed: polynucleotides, polypeptides, and polysaccharides. The polynucleotides, RNA and DNA, are long polymers of nucleotides. Polypeptides include proteins and shorter polymers of amino acids; some major examples include collagen, actin, and fibrin. Polysaccharides are linear or branched chains of sugar carbohydrates; examples include starch, cellulose, and alginate. Other examples of biopolymers include natural rubbers (polymers of isoprene), suberin and lignin (complex polyphenolic polymers), cutin and cutan (complex polymers of long-chain fatty acids), melanin, and polyhydroxyalkanoates (PHAs).
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Recent studies have discovered a pathway that links stress to the onset of disease through the activation of certain genes. The experience of psychological stress activates transcription factors that activate genes. In a study by Cole et al., it was concluded that GABA-1 transcription factor activates the interleukin-6-gene. This gene codes for a protein that activates the inflammatory response which directs an immune response to the site of the inflammation. Chronic inflammation makes an individual more susceptible to diseases such as cancer, heart disease, and diabetes. Another study found that physical stress caused increased cortisol:DHEAS (dehydroepiandrosterone sulphate) molar ratios which may contribute to reduced immunity, especially in the elderly for whom cortisol:DHEAS ratios are already increased. This is because DHEAS levels decrease with age while cortisol levels do not. This high ratio was found to suppress the activity of neutrophils and raise susceptibility for infection.
Sources: pubmed.ncbi.nlm.nih.gov
Selank is a synthetic heptapeptide designed as a stabilized analog of the natural tetrapeptide tuftsin. It has been investigated mainly for anxiolytic and cognitive effects. It is not an approved pharmaceutical in most countries.
It was developed in Russia, at the Institute of Molecular Genetics of the Russian Academy of Sciences, during the 1990s. Most published research originates from Russian institutions. Independent international replication remains limited.
Tuftsin is a natural tetrapeptide with the sequence Thr-Lys-Pro-Arg that participates in immune signaling. Selank extends that sequence with Pro-Gly-Pro at the C-terminus. The added residues are linked to greater resistance to enzymatic breakdown.
Dry powder is normally held at -20 degrees Celsius or below in a sealed, light-protected container with desiccant. Brief room-temperature handling during weighing is generally tolerated. Storage instructions vary between suppliers, so the accompanying certificate of analysis should be followed.