The short version of Pro-Gly-Pro fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-11-13 and is reviewed periodically as new material appears.
Characterization of Selank in a laboratory setting relies on standard peptide methods. Reverse-phase high-performance liquid chromatography separates the target from related impurities and provides a purity figure, commonly reported as 95 percent or higher. Mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, confirms the molecular mass and helps detect truncation or modification. Amino acid analysis can verify composition when a sequence-level check is needed. These techniques together establish identity and purity for a given lot.
Lyophilized Selank, the dry powder form, is generally stored frozen at minus 20 degrees Celsius or colder for long-term keeping. The solid is hygroscopic and should stay sealed, dry, and protected from light. Once dissolved, the peptide is less stable and is usually held refrigerated at 2 to 8 degrees Celsius for short periods. Repeated freezing and thawing is avoided because it can promote aggregation and loss of activity. Buffers and pH choice also affect how long a solution remains usable.
Selank is studied chiefly as an animal-model anxiolytic with proposed secondary effects on memory and immune signaling. Reported mechanisms include modulation of the GABA-A receptor complex, inhibition of enkephalin-degrading enzymes, and shifts in monoamine turnover within limbic structures. Some experiments describe increased expression of brain-derived neurotrophic factor in the hippocampus after repeated dosing. No single molecular target has been confirmed, and the peptide does not bind any receptor with the selectivity typical of a conventional small-molecule drug. Mechanism therefore remains a set of hypotheses rather than an established pathway.
Laboratory work relies on standard behavioral paradigms. Rodents are tested in the elevated plus maze, open field, and passive avoidance tasks, with outcomes compared against diazepam or vehicle controls. Intranasal dosing is used most often because it bypasses first-pass metabolism, though intraperitoneal and intravenous routes also appear in published protocols. Biochemical endpoints include tissue BDNF concentrations, cytokine levels, and monoamine metabolites. Human data are limited to small Russian trials reporting reduced anxiety scores; most were not prospectively registered, and few employed independent outcome assessment.
Measuring peptide exposure inside the brain is technically difficult. Selank is degraded rapidly in plasma, and assays must separate intact peptide from fragments, which favors targeted mass spectrometry over immunoassays alone. Reported half-lives are short, on the order of minutes, so effects observed hours later are attributed to downstream signaling rather than to the parent compound. Blood-brain barrier permeability is debated and rarely quantified directly. Gaps include absent dose-response characterization, inconsistent reporting of purity, and almost no pharmacokinetic data from human participants.
| Property | Value | Notes |
|---|---|---|
| Solubility | Freely soluble in water | Also in aqueous buffers |
| Typical purity (HPLC) | 95 percent or higher | Lot-dependent |
| Dry powder storage | Minus 20 degrees Celsius | Sealed, dry, protected from light |
| Solution storage | 2 to 8 degrees Celsius | Short-term use |
| Identity confirmation | Mass spectrometry | ESI or MALDI-TOF |
Dry powder is normally held at -20 degrees Celsius or lower, in a sealed container with desiccant and protection from light. Reconstituted solutions are usually kept at 2 to 8 degrees Celsius for short periods and frozen for longer ones. Proline residues at several positions are generally associated with some resistance to peptidase attack, but chemical stability still declines at neutral to alkaline pH and at elevated temperature. Exact shelf-life figures are product-specific and are not standardised across suppliers.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, with mass spectrometry used to confirm molecular mass and sequence information. Amino acid analysis and peptide mapping may supplement these methods. Certified reference standards are scarce, and many commercial lots are sold as research chemicals without a pharmacopoeial monograph. Regulatory treatment differs by country: Selank is a registered prescription medicine in Russia, while in the European Union and the United States it is not an approved drug and may fall under research-chemical or unapproved-product frameworks.
Clinical evidence comes mainly from small studies conducted in Russia, several of which were open-label or lacked robust blinding. Reported outcomes include lower anxiety scores, changes in attention measures, and effects on asthenic states following illness. Sample sizes are typically in the tens of participants, and independent replication outside the region is scarce. Reviews published in English generally note the limited methodological quality of the underlying trials. Whether the compound produces clinically meaningful effects under rigorous conditions remains unresolved.
Proposed mechanisms center on modulation of the GABA system, but no single molecular target has been confirmed. Rodent studies report changes in GABA-A receptor expression and in the turnover of serotonin, dopamine, and norepinephrine in several brain regions. Increases in brain-derived neurotrophic factor and its receptor have also been described after repeated administration. These findings come largely from animal models, and the degree to which they describe human neurochemistry remains an open question. The mechanism is best characterized as multi-system and not fully resolved.
Pharmacokinetic data are limited. Like most short peptides, Selank is vulnerable to plasma and tissue peptidases, and its measured half-life in circulation is short, on a minutes scale. The Pro-Gly-Pro tail slows this degradation but does not eliminate it. Intranasal administration is the route described in most reports, with absorption through the nasal mucosa and a hypothesized path into the central nervous system that avoids the blood-brain barrier. Direct measurements of human brain exposure are unavailable, so distribution claims rest on inference from animal work.
Reported pharmacological effects center on reduced anxiety-like behavior in animal models and on measures of memory and learning. Proposed contributing mechanisms include modulation of GABAergic signaling, shifts in monoamine turnover, and changes in the activity of enzymes that degrade neuropeptides. Effects on the expression of genes linked to neuroplasticity have also been described. No single molecular target is widely accepted, and whether the behavioral findings arise from one pathway or several remains an open question.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed as a stabilized analogue of tuftsin, a naturally occurring tetrapeptide fragment derived from the immunoglobulin heavy chain. The additional Pro-Gly-Pro segment at the carboxyl terminus is intended to slow enzymatic cleavage. The compound is usually described in the literature as a synthetic peptide with anxiolytic and cognitive-related activity, a label that reflects a research context rather than an approved therapeutic category.
Animal studies have examined behaviour in tests of anxiety, memory retention and stress response, and several report changes in neurotrophic or neurotransmitter-related markers. The human evidence base is much smaller, consisting mainly of short trials conducted in Russia with limited reporting in English-language journals. Sample sizes are modest and outcome measures vary between studies, so the findings are best described as preliminary. Independent replication under modern trial standards has not been widely reported.
Outside its country of origin the compound is generally handled as a research chemical rather than an approved medicine. No regulatory approval from the United States Food and Drug Administration or the European Medicines Agency has been granted for human use. Identity and purity are normally checked by reverse-phase high-performance liquid chromatography, with mass spectrometry used to confirm the molecular mass. Lyophilised material is stored cold and desiccated, and repeated freeze-thaw cycles are avoided.
Published work on this peptide almost always uses intranasal delivery, with drops or a spray applied to the nasal mucosa. Some animal experiments have used subcutaneous or intraperitoneal injection, and a smaller number have compared routes directly. Oral administration is not a focus of the literature, because short peptides of this size are broken down by digestive enzymes and cross intestinal barriers poorly. How much of an intranasal dose reaches the bloodstream intact in humans remains an open question.
== External links == PiHKAL ("Phenethylamines I Have Known And Loved") by Alexander "Sasha" Shulgin (1991) DOx - PsychonautWiki Category: DOX - Tripsitter DOx (psychedelics) - Wikipedia Massviews Analysis (Wikipedia Page Views of Individual DOx Drugs)
These cyclic dipeptides incorporate both donor and acceptor groups for hydrogen bonding. They are conformationally constrained nearly planar scaffolds. Diversity can be introduced at up to six positions and stereochemistry controlled at up to four positions. They are stable to proteolysis. These characteristics underpin theis biologically activity and utility in medicinal chemistry. As a consequence of their predominant biosynthetic origin from L-α-amino acids most naturally occurring 2,5-DKPs are cis configured as the cyclo(L-Xaa-L-Yaa) isomers. 2,5-DKPs epimerize under basic, acidic and thermal conditions. The composition of the cis and trans isomers in the equilibrium state varies widely depending on the bulk of the side chains, if a ring (e.g. proline) is present, or if the nitrogen atoms are alkylated . Although epimerization was historically an issue in the synthesis of 2,5-DKPs, several mild methods have been developed recently that avoid epimerization.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
Promising innovations relating to global challenges are demonstrated: an overview of "the nascent industry of AI-designed drugs" (1 June), after moderators of the Web content aggregation-based platform Reddit strike against the site's introduction of API pricing and the ensuing closing of several mobile client apps, several novel decentralized open source aggregation platforms gain substantial numbers of users – most notably Lemmy and Kbin which can synchronize their posts via interoperability (12 June), the first upgrade of the Global Earthquake Model data for disaster risk reduction is reported (13 June), first approval for two cultured meat products in the U.S. and two of the first worldwide (21 June), transgenic soya beans containing pig protein (Piggy Sooy) are reported (28 June), a new type of glass (LionGlass) that is substantially more damage-resistant and more sustainable is reported (30 June).
Ghana possesses industrial minerals, hydrocarbons and precious metals. It is an emerging designated digital economy with mixed economy hybridisation and an emerging market. It has an economic plan target known as the "Ghana Vision 2020". This plan envisions Ghana as the first African country to become a developed country between 2020 and 2029 and a newly industrialised country between 2030 and 2039. This excludes fellow Group of 24 member and Sub-Saharan African country South Africa, which is a newly industrialised country. Ghana's economy has ties to the Chinese yuan renminbi along with Ghana's gold reserves. In 2013, the Bank of Ghana began circulating the renminbi throughout Ghanaian state-owned banks and to the Ghana public as hard currency along with the national Ghanaian cedi for second national trade currency. Between 2012 and 2013, 38% of rural dwellers were experiencing poverty whereas 11% of urban dwellers were. Urban areas hold greater opportunity for employment, particularly in informal trade, while 94% of "rural poor households" participate in the agricultural sector. The Volta River Authority and the Ghana National Petroleum Corporation, both state-owned, are the two major electricity producers. The Akosombo Dam, built on the Volta River in 1965, along with the Bui Dam, the Kpong Dam and other hydroelectric dams, provide hydropower.
The white blood cell differential is a common blood test that is often ordered alongside a complete blood count. The test may be performed as part of a routine medical examination; to investigate certain symptoms, particularly those suggestive of infection or hematological disorders; or to monitor existing conditions, such as blood disorders and inflammatory diseases. Five types of white blood cells are normally found in blood: neutrophils, lymphocytes, monocytes, eosinophils and basophils. Marked shifts in the proportions of these cell types, as measured by the automated or manual differential, can indicate various health conditions. Additionally, cell types which do not normally occur in the blood, such as blast cells, can be identified by the manual differential. These cell types may be found in blood disorders and other pathological states. The manual differential can also identify changes in the appearance of white blood cells, such as reactive lymphocytes, or features such as toxic granulation and vacuolation in neutrophils. The results of the white blood cell differential are reported as percentages and absolute values. Absolute counts are usually reported in units of cells per microlitre (μL) or 109 cells per litre (L). The result are then compared against reference ranges, which are defined by individual laboratories and may vary due to different patient populations and testing methods. CBC and differential testing is usually performed on venous or capillary blood.
Tasipimidine (INNTooltip International Nonproprietary Name, USANTooltip United States Adopted Name; developmental code names ODM-105 and ORM-19695), sold under the brand name Tessie, is an α2-adrenergic receptor agonist which is approved for the short-term treatment of fear and anxiety in dogs. It is also under development for the treatment of insomnia in humans. The drug is used as an oral solution in dogs, whereas its route of administration for humans is unspecified. The drug acts as a potent and selective full agonist of the human α2A-adrenergic receptor. Conversely, it is a much weaker agonist of the rodent α2B-, α2C-, and α2D-adrenergic receptors. In addition, it shows only low affinity for α1-adrenergic receptors, where it appears to act as a partial agonist. Tasipimidine produces anxiolytic, sedative, hypolocomotor, hypotensive, and bradycardic effects in animals. Tasipimidine is under development for use in humans by Orion Corporation. As of October 2024, it is in phase 2 clinical trials for this indication. The drug is or was also under development for the treatment of psychiatric disorders in humans, but no recent development for this indication has been reported. It has reached phase 1 trials for psychiatric disorders. Tasipimidine was approved for treatment of fear and anxiety in dogs in the European Union in 2021.
Sources: en.wikipedia.org
For instance, the character Miss Ackerman from iCarly was described as "crazy" and "looney." The study concluded that progress in addressing mental illness representation in children's television has been limited, with many negative portrayals still present.
== History == ELGA Products Limited was founded in 1937 by Walter Lorch to manufacture domestic electrical appliances, but moved into water purification to overcome the problem of limescale deposits in steam irons. It developed a small cartridge-type deionizer to purify the water. ELGA collaborated with the London School of Pharmacy to develop products aimed at the hospital market, laboratories and general industry. A manufacturing unit was set up in 1959 in Lane End, Buckinghamshire, UK. During the 1960s ELGA became a global supplier of water purification systems. ELGA Group PLC was incorporated in 1984 and became part of Protean PLC in 1992. Protean PLC was acquired by Culligan Water Technologies (Northbrook Illinois) in 1997. Culligan was acquired by U.S. Filter (Palm Springs, California) in 1998. ELGA became part of USF Limited in 1999. U.S. Filter was acquired by Vivendi S.A. (Paris, France) in 2000. ELGA became part of Vivendi Water Systems Limited and then Veolia Water Systems LTD, part of the Veolia Group, in 2003. ELGA has added North American and Asian manufacturing operations to the original UK site.
=== Protein identification === There are two main ways MS is used to identify proteins. Peptide mass fingerprinting uses the masses of proteolytic peptides as input to a search of a database of predicted masses that would arise from digestion of a list of known proteins. If a protein sequence in the reference list gives rise to a significant number of predicted masses that match the experimental values, there is some evidence that this protein was present in the original sample. Purification steps therefore limit the throughput of the peptide mass fingerprinting approach. Alternatively, peptides can be fragmented with MS/MS to more definitively identify them. MS is also the preferred method for the identification of post-translational modifications in proteins versus other approaches such as antibody-based methods.
=== Pharmacokinetics === Topical hydrocortisone has minimal absorption into the body: Only 4-19% of the topical hydrocortisone cream applied would be absorbed into the human bloodstream. After a certain extent of absorption, it undergoes distribution, metabolism and elimination pathways that are similar to systemic hydrocortisone. Regarding the distribution of topical hydrocortisone, it binds to plasma proteins such as globulin and albumin, then the drug is mainly metabolized in the liver, and the metabolite will be excreted through bile or by kidneys.
== See also == Anorectic Eating disorder Fasting Food aversion (disambiguation) Ghrelin Gluttony Hunger strike Hypoglycemia Polyphagia Postprandial somnolence Satiety value Specific appetite Starvation Stomach rumble Taste aversion (disambiguation) Thirst Famine Prader–Willi syndrome
Sources: en.wikipedia.org
Reverse-phase HPLC is the usual method and gives a percentage purity value. Mass spectrometry then confirms the molecular mass. Together they provide a basic identity and purity profile for a lot.
Freeze-dried material is kept frozen, often at minus 20 degrees Celsius, and protected from light and moisture. Dissolved peptide is refrigerated for short-term use. Repeated freeze-thaw cycles are avoided.
A certificate of analysis typically lists purity by HPLC, the confirmed mass, appearance, and sometimes water or counter-ion content. It documents results for a specific batch. Details vary by supplier.
Intranasal administration predominates in both animal and human research because it avoids hepatic first-pass metabolism. Injectable and intraperitoneal routes appear in animal work mainly for comparison.