If you have been reading about reverse-phase HPLC and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Proposed mechanisms centre on modulation of the GABAergic system, with reports of altered expression of genes related to GABA-A receptor subunits and changed monoamine turnover. Some studies describe inhibition of enkephalinase, the enzyme that degrades endogenous enkephalins, which may prolong opioid peptide signalling. Effects on brain-derived neurotrophic factor and on cytokine expression have also been reported. These findings come largely from animal models and small human studies, and the precise primary target remains unresolved.
Published clinical evidence is limited. Most controlled trials were conducted in Russia, enrolled modest numbers of participants, and appeared in Russian-language journals, which restricts independent verification. Reported outcomes include lower anxiety scores, improved attention and memory measures, and changes in fatigue ratings. Reviews written in English note methodological limitations such as small samples and inconsistent endpoints. Whether the compound produces clinically meaningful benefit relative to established anxiolytics is therefore an open question rather than an established finding.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences as a structural analogue of tuftsin, a naturally occurring tetrapeptide fragment of the immunoglobulin heavy chain. The added Pro-Gly-Pro tail was intended to slow enzymatic degradation and extend biological activity. In Russia it is registered as an anxiolytic nasal preparation, while regulators elsewhere have not approved it for clinical use.
Quantification in biological matrices relies on liquid chromatography coupled to tandem mass spectrometry with stable-isotope internal standards. Low plasma concentrations and adsorption to container surfaces both complicate measurement. Solid-phase extraction is often needed to reduce matrix interference before injection. Reported limits of quantification differ widely between laboratories, which makes direct comparison of pharmacokinetic results difficult and limits meta-analysis.
Peptide bonds are vulnerable to protease attack, and Selank is no exception. Measured half-life in serum is short, on the order of minutes in several reports, which explains why intranasal administration is the common route described in the literature. Absorption across the nasal mucosa partially bypasses first-pass hepatic metabolism. Quantitative data on human bioavailability remain limited and are difficult to compare across studies.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C33H57N11O9 | Free peptide form |
| Molecular mass | About 751.9 Da | Calculated average mass |
| Amino acid sequence | Thr-Lys-Pro-Arg-Pro-Gly-Pro | Single-letter form TKPRPGP |
| Structural basis | Tuftsin analogue | Extended version of a natural tetrapeptide |
| Development origin | Russian Academy of Sciences | Work carried out from the 1980s onward |
Lyophilized Selank, the dry powder form, is generally stored frozen at minus 20 degrees Celsius or colder for long-term keeping. The solid is hygroscopic and should stay sealed, dry, and protected from light. Once dissolved, the peptide is less stable and is usually held refrigerated at 2 to 8 degrees Celsius for short periods. Repeated freezing and thawing is avoided because it can promote aggregation and loss of activity. Buffers and pH choice also affect how long a solution remains usable.
Solubility behavior is a practical concern for handling. Selank dissolves readily in water and in common aqueous buffers, which simplifies preparation of working solutions. The choice of solvent, ionic strength, and pH can influence aggregation over time, particularly at higher concentrations. Aqueous solutions are typically sterile-filtered before use. Because stability depends on several variables, storage and handling notes should be treated as general guidance rather than fixed rules, and specific values are best confirmed against a certificate of analysis for each batch.
Characterization of Selank in a laboratory setting relies on standard peptide methods. Reverse-phase high-performance liquid chromatography separates the target from related impurities and provides a purity figure, commonly reported as 95 percent or higher. Mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, confirms the molecular mass and helps detect truncation or modification. Amino acid analysis can verify composition when a sequence-level check is needed. These techniques together establish identity and purity for a given lot.
Selank is a synthetic heptapeptide developed in Russia. Its sequence is Thr-Lys-Pro-Arg-Pro-Gly-Pro, a seven-residue chain built around the natural tetrapeptide tuftsin. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences first described the compound in the mid-1990s. The design combined the tuftsin core with an added Pro-Gly-Pro tail, a modification intended to extend the molecule's stability in biological fluids. Published work on the peptide has appeared mainly in Russian-language journals.
Reported activity for Selank centers on anxiolytic and nootropic effects. Russian clinical reports describe use in anxiety and in cognitive or attention-related complaints. Most of this evidence comes from studies conducted by the same research groups that developed the peptide. Independent replication in other countries remains limited, and no major Western regulatory agency has approved the compound for any indication. The gap between local reports and external verification is a recurring point in discussions of the peptide.
Tuftsin, the parent structure, is a naturally occurring immunomodulatory tetrapeptide released from the Fc region of immunoglobulin G by spleen enzymes. Selank extends this four-residue sequence with three additional amino acids. The stated rationale is that the added tail slows enzymatic breakdown and may influence receptor interactions. How the full heptapeptide behaves at the molecular level is not firmly established, and proposed mechanisms often involve indirect modulation of neurotransmitter or immune signaling rather than a single defined target.
Animal studies have examined behaviour in tests of anxiety, memory retention and stress response, and several report changes in neurotrophic or neurotransmitter-related markers. The human evidence base is much smaller, consisting mainly of short trials conducted in Russia with limited reporting in English-language journals. Sample sizes are modest and outcome measures vary between studies, so the findings are best described as preliminary. Independent replication under modern trial standards has not been widely reported.
Outside its country of origin the compound is generally handled as a research chemical rather than an approved medicine. No regulatory approval from the United States Food and Drug Administration or the European Medicines Agency has been granted for human use. Identity and purity are normally checked by reverse-phase high-performance liquid chromatography, with mass spectrometry used to confirm the molecular mass. Lyophilised material is stored cold and desiccated, and repeated freeze-thaw cycles are avoided.
Published work on this peptide almost always uses intranasal delivery, with drops or a spray applied to the nasal mucosa. Some animal experiments have used subcutaneous or intraperitoneal injection, and a smaller number have compared routes directly. Oral administration is not a focus of the literature, because short peptides of this size are broken down by digestive enzymes and cross intestinal barriers poorly. How much of an intranasal dose reaches the bloodstream intact in humans remains an open question.
Naming for this compound is not fully standardised in English sources. The spelling Selanc appears in some transliterations, and catalogue entries may instead list the peptide sequence itself as the identifier. Reference material sometimes groups it with other short synthetic peptides studied for behavioural effects, which can create confusion when citations are compared. Distinguishing the exact sequence from related tuftsin analogues is therefore a practical first step when reviewing any dataset or specification sheet.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, frequently abbreviated as TKPRPGP. It was designed as a structural analogue of tuftsin, a naturally occurring tetrapeptide released by enzymatic cleavage of the immunoglobulin heavy chain. The two additional proline residues at the C-terminal end extend the parent chain and change how the molecule behaves in solution. The free peptide has a calculated molecular mass of approximately 751.9 g/mol and is generally supplied as a lyophilised white to off-white powder.
Development work on the compound began in the 1980s and 1990s at the Institute of Molecular Genetics in Moscow, within the same research programme that produced the peptide Semax. Early investigators sought a tuftsin derivative with improved resistance to enzymatic breakdown and with activity in the central nervous system after peripheral administration. Most of the primary literature from this period was published in Russian, a factor that still shapes how easily the findings can be checked by outside groups.
=== Singles === "Since You Broke My Heart" / "We Know" — Reprise 0324 — released November 1964 "I'm A Fool" / "So Many Ways" — Reprise 0367 – May 1965 (No. 17 U.S., No. 23 CAN) "I'm A Fool" / "So Many Ways" / "Since You Broke My Heart" / "We Know" — Reprise 60072 ep (France) – May 1965 "Not The Lovin' Kind" / "Chimes of Freedom" — Reprise 0401 – September 1965 (No. 25 U.S., No. 15 Canada) "Please Don't Fight It" / "The Rebel Kind" — Reprise 0426 – November 1965 (No. 25 Canada) "Superman" / "I Can't Get Her Off My Mind" — Reprise 0444 – February 1966 (No. 94 U.S., No. 15 Canada) "Tie Me Down" / "It's Just The Way You Are" — Reprise 0462 – April 1966 "Look Out Girls (Here We Come)" / "She's So Far Out She's In" — Reprise 0469 – July 1966 "I Hope She's There Tonight" / "Josephine" — Reprise 0529 – November 1966 "If You're Thinkin' What I'm Thinkin'" / "Pretty Flamingo" — Reprise 0544 – January 1967 (No. 128 U.S., No. 2 CAN) "Two in the Afternoon" / "Good Luck, Best Wishes to You" — Reprise 0579 – April 1967 (No. 99 U.S., No. 5 CAN) "Kitty Doyle" / "Without Hurtin' Some" — Reprise 0619 – August 1967 (No. 108 U.S.) "My What a Shame" / "The Inside Outside Caspar Milquetoast Eskimo Flash" — Reprise 0653 – January 1968 "Tell Someone You Love Them" / "General Outline" — Reprise 0698 – June 1968 (No. 92 U.S., No. 67 Canada) "Thru Spray Colored Glasses" / "Someday" — Uni 55127 – April 1969 "Hawley" / "Let's Talk it Over" — Columbia 4-44975 – August 1969 "Lady Love" / "A Certain Sound" — Reprise 0965 – November 1970
These two drugs work synergistically and were found to be more effective than either drug alone. The development of nanotechnology and molecular biology has provided the improvement of nanomaterials with specific properties which are now able to overcome the weaknesses of traditional disease diagnostic and therapeutic procedures. In recent years, more attention has been devoted to designing and the development of new methods for realizing sustained release of diverse drugs. Since each drug has a plasma level above which is toxic and below which is ineffective and in conventional drug delivery, the drug concentration in the blood rises quickly and then declines, the main aim of an ideal drug delivery system (DDS) is to maintain the drug within a desired therapeutic range after a single dose, and/or target the drug to a specific region while simultaneously lowering the systemic levels of the drug. Graphene–based materials such as graphene oxide (GO) have considerable potential for several biological applications including the development of new drug release system. GOs are an abundance of functional groups such as hydroxyl, epoxy, and carboxyl on its basal surface and edges that can be also used to immobilize or load various biomolecules for biomedical applications. On the other side, biopolymers have frequently been used as raw materials for designing drug delivery formulations owing to their excellent properties, such as non-toxicity, biocompatibility, biodegradability and environmental sensitivity, etc.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Sources: en.wikipedia.org
== Diagnosis == In order to qualify a patient's condition as BSS, the bending angle must be greater than 45 degrees. While the presence of the condition is very easy to note, the cause of the condition is much more difficult to discern. Conditions not considered to be BSS include vertebral fractures, previously existing conditions, and ankylosing spondylitis. Lower-back CT scans and MRIs can typically be used to visualize the cause of the disease. Further identification of the cause can be done by histochemical or cellular analysis of muscle biopsy.
=== Impacts of the underrepresentation of women in certain research and clinical trials === Historically, women were often excluded from clinical trials for reasons such as hormonal variability or concerns about pregnancy-related risks. This exclusion has limited understanding of how certain diseases and treatments affect women. For example, women's cardiovascular diseases—the leading cause of death among women—remain under-researched, and treatment outcomes are often less favorable for women. Other areas with gender data gaps include HIV, some cancers, and the side effects of medication. Due to underrepresentation in trials, women experience more side effects—up to twice as many as men—which has both health and financial consequences, as noted by the French Academy of Medicine in 2016. Drug efficacy may also differ by sex.
The fake news, fueled by disinformation, mainly from right-wing figures such as Nikolas Ferreira, which circulated widely, was denied both by the government and by the Federal Revenue Service, the Central Bank, and news outlets. Despite the denials, the negative repercussions affected users' confidence, resulting in the biggest drop in the use of Pix since the creation of the system. Between 4 and 10 January 2025, 1.25 billion reais in Pix transactions were carried out, a reduction of almost 11% compared with December. This was the largest monthly drop recorded since January 2022. However, according to the Central Bank, the drop was not related to the wave of fake news, but rather to Christmas. On 15 January 2025, after the negative repercussions, the Minister of Finance, Fernando Haddad, announced that the government would revoke the act that expanded the oversight of the Federal Revenue Service over the new financial transactions. Haddad also stated that the president would sign a provisional measure to guarantee that Pix cannot be taxed. Later, the Federal Revenue Service pointed out that the revocation of the oversight weakened the monitoring of financial operations and favored organized crime organizations, and Robinson Barreirinhas, special secretary of the agency, stated that the Federal Revenue Service suffered "the greatest attack in its history" when he wrote: "We published this instruction in September of last year [2024], to take effect from January. What happened in January we all know.
Chromosome 3 open reading frame 62 (C3orf62) is a protein that in humans is encoded by the C3orf62 gene. C3orf62 is a glycine-depleted protein relative to the amount of glycine in proteins in the rest of the genome. C3orf62 has a KKXX-like motif and is predicted to be localized in the nucleus. Expression of C3orf62 remains highest in whole blood.
Sources: en.wikipedia.org
It is a seven-amino-acid peptide, Thr-Lys-Pro-Arg-Pro-Gly-Pro, produced by chemical synthesis rather than extracted from biological tissue. Its design is based on tuftsin, a natural immunomodulatory tetrapeptide. The C-terminal Pro-Gly-Pro segment is a common stabilising motif in short regulatory peptides.
The core four residues correspond to tuftsin, which occurs naturally as part of immunoglobulin G. The full seven-residue sequence, however, is not a known endogenous peptide. It is a laboratory-designed analogue intended to combine tuftsin-like activity with greater resistance to breakdown.
No single receptor has been confirmed as the primary target. Reports describe involvement of the GABAergic system, interference with enkephalin degradation, and shifts in neurotrophic factor expression. Because these observations come from different models and assays, they have not yet been integrated into one accepted mechanism.
Dry powder is best kept sealed, protected from light, and held at minus 20 degrees Celsius or below. Desiccant packaging helps limit moisture uptake because the material is hygroscopic. A sealed vial should be allowed to equilibrate to room temperature before opening to reduce condensation.